PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12855-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 280aa    MW: 30929.2 Da    PI: 6.7182
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12855-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.2e-134488347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+ l++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  TRIUR3_12855-P1 44 PWTEEEHRLFLLGLQKLGKGDWRGISRSFVVSRTPTQVASHAQKY 88
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5473793IPR017930Myb domain
SMARTSM007172.2E-104191IPR001005SANT/Myb domain
SuperFamilySSF466899.72E-164294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-114387IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-174392IPR006447Myb domain, plants
PfamPF002495.2E-114488IPR001005SANT/Myb domain
CDDcd001671.58E-94489No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MASLFPPLAP RTVSASVCFW LTHRLQVHLP TAAPHAALSL SGTPWTEEEH RLFLLGLQKL  60
GKGDWRGISR SFVVSRTPTQ VASHAQKYFI RQTNFSRRKR RSSLFDMVPE MRLSAFSTYV  120
KLPADTCAFL FNLKPMDESP DGAEEFTLCS TQDETSSSNK LSLFHLGRQK EAECDKDLPT  180
LQLRQHEESE YGGPSLEAPD LEMNNGVSFK AASVSTVPAF YPSLLPVPLT LWPANVSNVE  240
AANASHEVLK PTPVNLKEAI KADEVVSMSK LSIGGDLLET
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564624.11e-116PREDICTED: uncharacterized protein LOC100828575
TrEMBLM8AST40.0M8AST4_TRIUA; Transcription factor MYB1R1
STRINGMLOC_76271.11e-142(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-29MYB_related family protein